A Randomized, Double-blind, Active-controlled, Two Parallel-Group, Optional Titration, Multicenter, Phase IIIb Study to Evaluate the Efficacy and Safety of Fimasartan Versus Perindopril Monotherapy With and Without a Diuretic Combination in Elderly Patients With Essential Hypertension

  • Lee, Hae-Young
  • Kim, Kwang-Il
  • Ihm, Sang Hyun
  • Rhee, Moo-Yong
  • Sohn, Il Suk
  • ... Kim, Eung Ju
  • 외 18명
Citations

WEB OF SCIENCE

1
Citations

SCOPUS

2

초록

Purpose: The efficacy and tolerability of fimasartan in elderly patients have not been fully evaluated. This study was therefore conducted to determine the efficacy and tolerability of fimasartan compared with perindopril in elderly Korean patients aged > 70 years with essential hypertension (defined by a mean sitting systolic blood pressure [SBP] >140 mm Hg). Methods: This randomized, double-blind, active controlled, 2 parallel-group, optional titration, multicenter, Phase IIIb trial (FITNESS [Fimasartan in the Senior Subjects]) enrolled 241 patients from 23 cardiac centers in the Republic of Korea between August 2017 and December 2019. After the placebo run-in period, treatment started with fimasartan 30 mg or perindopril arginine 2.5 mg once daily at a 1:1 ratio; if BP was not controlled at week 4, the dose was doubled. If BP was not controlled at week 8, a diuretic combination (fimasartan 60 mg/hydrochlorothiazide 12.5 mg or perindopril arginine 5 mg/indapamide 1.25 mg) was administered. After 16 weeks of the double-blind treatment, the patients with controlled BP participated in an 8-week open-label extension study, with the 2 groups unified by fimasartan 60 mg with or without hydrochlorothiazide 12.5 mg for 8 weeks. The primary outcome was a change in SBP for 8 weeks. The secondary outcomes included a change in sitting diastolic BP (DBP) for 8 weeks and changes in SBP and DBP for 4, 16, and 24 weeks. Findings: At week 8, mean SBP significantly decreased from baseline in both groups: -14.2 (14.4) mm Hg in the fimasartan group and -9.0 (16.1) mm Hg in the perindopril group. The difference between the 2 groups was 5.4 (2.1) mm Hg, indicating the noninferiority of fimasartan to perindopril. Moreover, fimasartan exhibited a higher BP-lowering effect than perindopril ( P = 0.0108). In addition, reductions in SBP and DBP from baseline to weeks 4, 8, and 16 were significantly greater in the fimasartan group than in the perindopril group, although the SBP reduction was comparable at week 16. Both groups reported an excellent mean compliance rate of 97.4% (4.7%) through week 16. During the study period, 82 adverse events were reported in 52 patients, 40 in the fimasartan group and 42 in the perindopril group ( P = 0.4647). Dizziness was the most commonly reported adverse event (7 cases). Remarkably, only 1 case of orthostatic hypotension was reported during the study period. Implications: In elderly patients with essential hypertension, fimasartan 30 to 60 mg with a possible hydrochlorothiazide 12.5-mg combination was noninferior to perindopril 2.5 to 5 mg with a possible indapamide 1.25-mg combination. Furthermore, fimasartan exhibited higher BP-lowering efficacy than perindopril. There was no difference in tolerability between the 2 groups. Clinicaltrials.gov Identifier: NCT03246555. (Clin Ther. 2021;43:1746-1756.) (c) 2021 Elsevier Inc.

키워드

angiotensin-converting enzyme inhibitorangiotensin receptor blockerelderlyfimasartanhypertensionperindoprilBLOOD-PRESSURE RESPONSEORTHOSTATIC HYPOTENSIONKOREAN PATIENTSINHIBITORSOUTCOMESFRAILTYTRIALRISKAGEMG
제목
A Randomized, Double-blind, Active-controlled, Two Parallel-Group, Optional Titration, Multicenter, Phase IIIb Study to Evaluate the Efficacy and Safety of Fimasartan Versus Perindopril Monotherapy With and Without a Diuretic Combination in Elderly Patients With Essential Hypertension
저자
Lee, Hae-YoungKim, Kwang-IlIhm, Sang HyunRhee, Moo-YongSohn, Il SukPark, SunghaJeon, Eun-SeokSong, Jong-MinPyun, Wook BumSung, Ki-ChulKim, Moo HyunKim, Sang-HyunKim, Seok-YeonKim, Shin-JaeKim, Eung JuShin, JinhoLee, Sung YunChun, Kook-JinJeong, Jin-OkChae, Shung ChullYoo, Ki DongChoi, Young JinPark, Yong HwanKim, Cheol-Ho
DOI
10.1016/j.clinthera.2021.08.003
발행일
2021-10
유형
Article
저널명
Clinical Therapeutics
43
10
페이지
1746 ~ 1756